IL20RB purified MaxPab mouse polyclonal antibody (B02P)
  • IL20RB purified MaxPab mouse polyclonal antibody (B02P)

IL20RB purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00053833-B02P
IL20RB purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IL20RB protein.
Información adicional
Size 50 ug
Gene Name IL20RB
Gene Alias DIRS1|FNDC6|IL-20R2|MGC34923
Gene Description interleukin 20 receptor beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MKHLLMWSPVIAPGETVYHSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEERPFPWYWPCLPLLASC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL20RB (AAH33292.1, 1 a.a. ~ 147 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 53833

Enviar uma mensagem


IL20RB purified MaxPab mouse polyclonal antibody (B02P)

IL20RB purified MaxPab mouse polyclonal antibody (B02P)