GPR84 monoclonal antibody (M01), clone 5C3
  • GPR84 monoclonal antibody (M01), clone 5C3

GPR84 monoclonal antibody (M01), clone 5C3

Ref: AB-H00053831-M01
GPR84 monoclonal antibody (M01), clone 5C3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant GPR84.
Información adicional
Size 100 ug
Gene Name GPR84
Gene Alias EX33|GPCR4
Gene Description G protein-coupled receptor 84
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GPR84 (NP_065103, 208 a.a. ~ 316 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 53831
Clone Number 5C3
Iso type IgG1 Kappa

Enviar uma mensagem


GPR84 monoclonal antibody (M01), clone 5C3

GPR84 monoclonal antibody (M01), clone 5C3