MBD3 MaxPab rabbit polyclonal antibody (D01)
  • MBD3 MaxPab rabbit polyclonal antibody (D01)

MBD3 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00053615-D01
MBD3 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MBD3 protein.
Información adicional
Size 100 uL
Gene Name MBD3
Gene Alias -
Gene Description methyl-CpG binding domain protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MBD3 (NP_003917.1, 1 a.a. ~ 291 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 53615

Enviar uma mensagem


MBD3 MaxPab rabbit polyclonal antibody (D01)

MBD3 MaxPab rabbit polyclonal antibody (D01)