MBD3 purified MaxPab mouse polyclonal antibody (B01P)
  • MBD3 purified MaxPab mouse polyclonal antibody (B01P)

MBD3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00053615-B01P
MBD3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MBD3 protein.
Información adicional
Size 50 ug
Gene Name MBD3
Gene Alias -
Gene Description methyl-CpG binding domain protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MBD3 (NP_003917.1, 1 a.a. ~ 291 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 53615

Enviar uma mensagem


MBD3 purified MaxPab mouse polyclonal antibody (B01P)

MBD3 purified MaxPab mouse polyclonal antibody (B01P)