MBD3 polyclonal antibody (A01)
  • MBD3 polyclonal antibody (A01)

MBD3 polyclonal antibody (A01)

Ref: AB-H00053615-A01
MBD3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MBD3.
Información adicional
Size 50 uL
Gene Name MBD3
Gene Alias -
Gene Description methyl-CpG binding domain protein 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq LMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MBD3 (NP_003917, 70 a.a. ~ 179 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 53615

Enviar uma mensagem


MBD3 polyclonal antibody (A01)

MBD3 polyclonal antibody (A01)