STX18 polyclonal antibody (A01)
  • STX18 polyclonal antibody (A01)

STX18 polyclonal antibody (A01)

Ref: AB-H00053407-A01
STX18 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant STX18.
Información adicional
Size 50 uL
Gene Name STX18
Gene Alias DKFZp686O15149|Ufe1
Gene Description syntaxin 18
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QIFMRTCSEAIQQLRTEAHKEIHSQQVKEHRTAVLDFIEDYLKRVCKLYSEQRAIRVKRVVDKKRLSKLEPEPNTKTRESTSSEKVSQSPSKDSEENPA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STX18 (NP_058626, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 53407

Enviar uma mensagem


STX18 polyclonal antibody (A01)

STX18 polyclonal antibody (A01)