UBASH3A MaxPab mouse polyclonal antibody (B01P)
  • UBASH3A MaxPab mouse polyclonal antibody (B01P)

UBASH3A MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00053347-B01P
UBASH3A MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human UBASH3A protein.
Información adicional
Size 50 ug
Gene Name UBASH3A
Gene Alias CLIP4|STS-2|TULA
Gene Description ubiquitin associated and SH3 domain containing, A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAAGETQLYAKVSNKLKGRSSPSLLEPLLAMGFPVHTALKALAATGRKTAEEALAWLHDHCNDPSLDDPIPQEYALFLCPTGPLLEKLQEFWRESKRQCAKNRAHEVFPHVTLCDFFTCEDQKVECLYEALKRAGDRLLGSFPTAVPLALHSSISYLGFFVSGSPADVIREFAMTFATEASLLADCSVKPCTKQLHLTLAHKFYPHHQRTLEQLARAIPLGHSCQWTAALYSRDMRFVHYQTLRALFQYKPQNVD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen UBASH3A (AAH28138.1, 1 a.a. ~ 451 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 53347

Enviar uma mensagem


UBASH3A MaxPab mouse polyclonal antibody (B01P)

UBASH3A MaxPab mouse polyclonal antibody (B01P)