IL17D MaxPab rabbit polyclonal antibody (D01)
  • IL17D MaxPab rabbit polyclonal antibody (D01)

IL17D MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00053342-D01
IL17D MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IL17D protein.
Información adicional
Size 100 uL
Gene Name IL17D
Gene Alias FLJ30846|IL-17D|IL-22|IL-27|IL27
Gene Description interleukin 17D
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL17D (NP_612141.1, 1 a.a. ~ 202 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 53342

Enviar uma mensagem


IL17D MaxPab rabbit polyclonal antibody (D01)

IL17D MaxPab rabbit polyclonal antibody (D01)