SPA17 monoclonal antibody (M03), clone 3B6
  • SPA17 monoclonal antibody (M03), clone 3B6

SPA17 monoclonal antibody (M03), clone 3B6

Ref: AB-H00053340-M03
SPA17 monoclonal antibody (M03), clone 3B6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SPA17.
Información adicional
Size 100 ug
Gene Name SPA17
Gene Alias SP17|SP17-1
Gene Description sperm autoantigenic protein 17
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq EKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPA17 (NP_059121, 51 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 53340
Clone Number 3B6
Iso type IgG2a Kappa

Enviar uma mensagem


SPA17 monoclonal antibody (M03), clone 3B6

SPA17 monoclonal antibody (M03), clone 3B6