BTBD1 purified MaxPab mouse polyclonal antibody (B01P)
  • BTBD1 purified MaxPab mouse polyclonal antibody (B01P)

BTBD1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00053339-B01P
BTBD1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human BTBD1 protein.
Información adicional
Size 50 ug
Gene Name BTBD1
Gene Alias C15orf1|NS5ATP8
Gene Description BTB (POZ) domain containing 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASLGPAAAGEQASGAEAEPGPAGPPPPPSPSSLGPLLPLQREPLYNWQATKASLKERFAFLFNSELLSDVRFVLGKGRGAAAAGGPQRIPAHRFVLAAGSAVFDAMFNGGMATTSAEIELPDVEPAAFLALLRFLYSDEVQIGPETVMTTLYTAKKYAVPALEAHCVEFLTKHLRADNAFMLLTQARLFDEPQLASLCLDTIDKSTMDAISAEGFTDIDIDTLCAVLERDTLSIRESRLFGAVVRWAEAECQRQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen BTBD1 (NP_079514.1, 1 a.a. ~ 482 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 53339

Enviar uma mensagem


BTBD1 purified MaxPab mouse polyclonal antibody (B01P)

BTBD1 purified MaxPab mouse polyclonal antibody (B01P)