TUBA8 purified MaxPab rabbit polyclonal antibody (D01P)
  • TUBA8 purified MaxPab rabbit polyclonal antibody (D01P)

TUBA8 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051807-D01P
TUBA8 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human TUBA8 protein.
Información adicional
Size 100 ug
Gene Name TUBA8
Gene Alias TUBAL2
Gene Description tubulin, alpha 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MRECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQASKINDDDSFTTFFSETGNGKHVPRAVMIDLEPTVVDEVRAGTYRQLFHPEQLITGKEDAANNYARGHYTVGKESIDLVLDRIRKLTDACSGLQGFLIFHSFGGGTGSGFTSLLMERLSLDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TUBA8 (NP_061816.1, 1 a.a. ~ 449 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51807

Enviar uma mensagem


TUBA8 purified MaxPab rabbit polyclonal antibody (D01P)

TUBA8 purified MaxPab rabbit polyclonal antibody (D01P)