MYOZ2 purified MaxPab mouse polyclonal antibody (B01P)
  • MYOZ2 purified MaxPab mouse polyclonal antibody (B01P)

MYOZ2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051778-B01P
MYOZ2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MYOZ2 protein.
Información adicional
Size 50 ug
Gene Name MYOZ2
Gene Alias C4orf5|CS-1
Gene Description myozenin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKRVSIPRDIMLEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIPPEKFNTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKASRMVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVITTEPTDD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MYOZ2 (AAH05195.1, 1 a.a. ~ 264 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51778

Enviar uma mensagem


MYOZ2 purified MaxPab mouse polyclonal antibody (B01P)

MYOZ2 purified MaxPab mouse polyclonal antibody (B01P)