Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ZAK monoclonal antibody (M03), clone 3G5
Abnova
ZAK monoclonal antibody (M03), clone 3G5
Ref: AB-H00051776-M03
ZAK monoclonal antibody (M03), clone 3G5
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ZAK.
Información adicional
Size
100 ug
Gene Name
ZAK
Gene Alias
AZK|MLK7|MLT|MLTK|MRK|mlklak
Gene Description
sterile alpha motif and leucine zipper containing kinase AZK
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,IHC-P,ELISA,IF
Immunogen Prot. Seq
MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHY
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ZAK (AAH01401, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
51776
Clone Number
3G5
Iso type
IgG3 Lambda
Enviar uma mensagem
ZAK monoclonal antibody (M03), clone 3G5
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*