RP6-213H19.1 monoclonal antibody (M03), clone 3G5
  • RP6-213H19.1 monoclonal antibody (M03), clone 3G5

RP6-213H19.1 monoclonal antibody (M03), clone 3G5

Ref: AB-H00051765-M03
RP6-213H19.1 monoclonal antibody (M03), clone 3G5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant RP6-213H19.1.
Información adicional
Size 100 ug
Gene Name RP6-213H19.1
Gene Alias MASK|MST4
Gene Description serine/threonine protein kinase MST4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRALPPYERSLIQRKYRMGQSKILCKP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RP6-213H19.1 (AAH17213, 1 a.a. ~ 137 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51765
Clone Number 3G5
Iso type IgG1 Kappa

Enviar uma mensagem


RP6-213H19.1 monoclonal antibody (M03), clone 3G5

RP6-213H19.1 monoclonal antibody (M03), clone 3G5