RP6-213H19.1 monoclonal antibody (M01), clone 2G6
  • RP6-213H19.1 monoclonal antibody (M01), clone 2G6

RP6-213H19.1 monoclonal antibody (M01), clone 2G6

Ref: AB-H00051765-M01
RP6-213H19.1 monoclonal antibody (M01), clone 2G6

Información del producto

Mouse monoclonal antibody raised against a full length recombinant RP6-213H19.1.
Información adicional
Size 100 ug
Gene Name RP6-213H19.1
Gene Alias MASK|MST4
Gene Description serine/threonine protein kinase MST4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRALPPYERSLIQRKYRMGQSKILCKP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RP6-213H19.1 (AAH17213, 1 a.a. ~ 137 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51765
Clone Number 2G6
Iso type IgG2b Kappa

Enviar uma mensagem


RP6-213H19.1 monoclonal antibody (M01), clone 2G6

RP6-213H19.1 monoclonal antibody (M01), clone 2G6