RP6-213H19.1 MaxPab rabbit polyclonal antibody (D01)
  • RP6-213H19.1 MaxPab rabbit polyclonal antibody (D01)

RP6-213H19.1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00051765-D01
RP6-213H19.1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RP6-213H19.1 protein.
Información adicional
Size 100 uL
Gene Name RP6-213H19.1
Gene Alias MASK|MST4
Gene Description serine/threonine protein kinase MST4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RP6-213H19.1 (NP_057626.2, 1 a.a. ~ 416 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 51765

Enviar uma mensagem


RP6-213H19.1 MaxPab rabbit polyclonal antibody (D01)

RP6-213H19.1 MaxPab rabbit polyclonal antibody (D01)