RAB8B monoclonal antibody (M01), clone 1E4
  • RAB8B monoclonal antibody (M01), clone 1E4

RAB8B monoclonal antibody (M01), clone 1E4

Ref: AB-H00051762-M01
RAB8B monoclonal antibody (M01), clone 1E4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAB8B.
Información adicional
Size 100 ug
Gene Name RAB8B
Gene Alias FLJ38125
Gene Description RAB8B, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTSFFRCSLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB8B (NP_057614.1, 101 a.a. ~ 207 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51762
Clone Number 1E4
Iso type IgG2b Kappa

Enviar uma mensagem


RAB8B monoclonal antibody (M01), clone 1E4

RAB8B monoclonal antibody (M01), clone 1E4