CROP polyclonal antibody (A01)
  • CROP polyclonal antibody (A01)

CROP polyclonal antibody (A01)

Ref: AB-H00051747-A01
CROP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CROP.
Información adicional
Size 50 uL
Gene Name CROP
Gene Alias LUC7A|OA48-18
Gene Description cisplatin resistance-associated overexpressed protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CROP (NP_006098, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51747

Enviar uma mensagem


CROP polyclonal antibody (A01)

CROP polyclonal antibody (A01)