CD244 purified MaxPab rabbit polyclonal antibody (D01P)
  • CD244 purified MaxPab rabbit polyclonal antibody (D01P)

CD244 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051744-D01P
CD244 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CD244 protein.
Información adicional
Size 100 ug
Gene Name CD244
Gene Alias 2B4|NAIL|NKR2B4|Nmrk|SLAMF4
Gene Description CD244 molecule, natural killer cell receptor 2B4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MLGQVVTLILLLLLKVYQGKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWPFLVIIVILSALFLGTLACFCVWRRKRKEKQS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CD244 (NP_057466.1, 1 a.a. ~ 365 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51744

Enviar uma mensagem


CD244 purified MaxPab rabbit polyclonal antibody (D01P)

CD244 purified MaxPab rabbit polyclonal antibody (D01P)