GHRL monoclonal antibody (M16), clone 4E8
  • GHRL monoclonal antibody (M16), clone 4E8

GHRL monoclonal antibody (M16), clone 4E8

Ref: AB-H00051738-M16
GHRL monoclonal antibody (M16), clone 4E8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant GHRL.
Información adicional
Size 100 ug
Gene Name GHRL
Gene Alias MTLRP|obestatin
Gene Description ghrelin/obestatin prepropeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GHRL (NP_057446, 24 a.a. ~ 117 a.a) full length recombinant protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51738
Clone Number 4E8
Iso type IgG2a Kappa

Enviar uma mensagem


GHRL monoclonal antibody (M16), clone 4E8

GHRL monoclonal antibody (M16), clone 4E8