GHRL monoclonal antibody (M06), clone 4E5
  • GHRL monoclonal antibody (M06), clone 4E5

GHRL monoclonal antibody (M06), clone 4E5

Ref: AB-H00051738-M06
GHRL monoclonal antibody (M06), clone 4E5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant GHRL.
Información adicional
Size 100 ug
Gene Name GHRL
Gene Alias MTLRP|obestatin
Gene Description ghrelin/obestatin prepropeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GHRL (AAH25791.1, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51738
Clone Number 4E5
Iso type IgG2a Kappa

Enviar uma mensagem


GHRL monoclonal antibody (M06), clone 4E5

GHRL monoclonal antibody (M06), clone 4E5