GHRL MaxPab mouse polyclonal antibody (B01P)
  • GHRL MaxPab mouse polyclonal antibody (B01P)

GHRL MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051738-B01P
GHRL MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human GHRL protein.
Información adicional
Size 50 ug
Gene Name GHRL
Gene Alias MTLRP|obestatin
Gene Description ghrelin/obestatin prepropeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GHRL (AAH25791, 1 a.a. ~ 117 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51738

Enviar uma mensagem


GHRL MaxPab mouse polyclonal antibody (B01P)

GHRL MaxPab mouse polyclonal antibody (B01P)