SEPX1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SEPX1 purified MaxPab rabbit polyclonal antibody (D01P)

SEPX1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051734-D01P
SEPX1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SEPX1 protein.
Información adicional
Size 100 ug
Gene Name SEPX1
Gene Alias HSPC270|MGC3344|MSRB1|SELR|SELX
Gene Description selenoprotein X, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLNDGPKPGQSRF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SEPX1 (NP_057416.1, 1 a.a. ~ 94 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51734

Enviar uma mensagem


SEPX1 purified MaxPab rabbit polyclonal antibody (D01P)

SEPX1 purified MaxPab rabbit polyclonal antibody (D01P)