SEPX1 polyclonal antibody (A01)
  • SEPX1 polyclonal antibody (A01)

SEPX1 polyclonal antibody (A01)

Ref: AB-H00051734-A01
SEPX1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SEPX1.
Información adicional
Size 50 uL
Gene Name SEPX1
Gene Alias HSPC270|MGC3344|MSRB1|SELR|SELX
Gene Description selenoprotein X, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEPX1 (NP_057416, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51734

Enviar uma mensagem


SEPX1 polyclonal antibody (A01)

SEPX1 polyclonal antibody (A01)