POLR3K purified MaxPab mouse polyclonal antibody (B01P)
  • POLR3K purified MaxPab mouse polyclonal antibody (B01P)

POLR3K purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051728-B01P
POLR3K purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human POLR3K protein.
Información adicional
Size 50 ug
Gene Name POLR3K
Gene Alias C11|C11-RNP3|My010|RPC10|RPC11|hRPC11
Gene Description polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen POLR3K (AAH11932, 1 a.a. ~ 108 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51728

Enviar uma mensagem


POLR3K purified MaxPab mouse polyclonal antibody (B01P)

POLR3K purified MaxPab mouse polyclonal antibody (B01P)