RAB23 MaxPab rabbit polyclonal antibody (D01)
  • RAB23 MaxPab rabbit polyclonal antibody (D01)

RAB23 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00051715-D01
RAB23 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RAB23 protein.
Información adicional
Size 100 uL
Gene Name RAB23
Gene Alias DKFZp781H0695|HSPC137|MGC8900
Gene Description RAB23, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAB23 (NP_057361.3, 1 a.a. ~ 237 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 51715

Enviar uma mensagem


RAB23 MaxPab rabbit polyclonal antibody (D01)

RAB23 MaxPab rabbit polyclonal antibody (D01)