RAB23 MaxPab rabbit polyclonal antibody (D01) View larger

Rabbit polyclonal antibody raised against a full-length human RAB23 protein.

AB-H00051715-D01

New product

RAB23 MaxPab rabbit polyclonal antibody (D01)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 uL
Gene Name RAB23
Gene Alias DKFZp781H0695|HSPC137|MGC8900
Gene Description RAB23, member RAS oncogene family
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAB23 (NP_057361.3, 1 a.a. ~ 237 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 51715

More info

Rabbit polyclonal antibody raised against a full-length human RAB23 protein.

Enviar uma mensagem

Rabbit polyclonal antibody raised against a full-length human RAB23 protein.

Rabbit polyclonal antibody raised against a full-length human RAB23 protein.