CYB5R1 purified MaxPab mouse polyclonal antibody (B01P)
  • CYB5R1 purified MaxPab mouse polyclonal antibody (B01P)

CYB5R1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051706-B01P
CYB5R1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CYB5R1 protein.
Información adicional
Size 50 ug
Gene Name CYB5R1
Gene Alias B5R.1|NQO3A2|humb5R2
Gene Description cytochrome b5 reductase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CYB5R1 (NP_057327.2, 1 a.a. ~ 305 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51706

Enviar uma mensagem


CYB5R1 purified MaxPab mouse polyclonal antibody (B01P)

CYB5R1 purified MaxPab mouse polyclonal antibody (B01P)