ACSL5 purified MaxPab mouse polyclonal antibody (B01P)
  • ACSL5 purified MaxPab mouse polyclonal antibody (B01P)

ACSL5 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051703-B01P
ACSL5 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ACSL5 protein.
Información adicional
Size 50 ug
Gene Name ACSL5
Gene Alias ACS2|ACS5|FACL5
Gene Description acyl-CoA synthetase long-chain family member 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MDALKPPCLWRNHERGKKDRDSCGRKNSEPGSPHSLEALRDAAPSQGLNFLLLFTKMLFIFNFLFSPLPTPALICILTFGAAIFLWLITRPQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSSPDQFVGIFAQNRPEWIISELACYTYSMVAVPLYDTLGPEAIVHIVNKADIAMVICDTPQKALVLIGNVE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ACSL5 (NP_057318.2, 1 a.a. ~ 739 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51703

Enviar uma mensagem


ACSL5 purified MaxPab mouse polyclonal antibody (B01P)

ACSL5 purified MaxPab mouse polyclonal antibody (B01P)