VPS29 polyclonal antibody (A01)
  • VPS29 polyclonal antibody (A01)

VPS29 polyclonal antibody (A01)

Ref: AB-H00051699-A01
VPS29 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant VPS29.
Información adicional
Size 50 uL
Gene Name VPS29
Gene Alias DC15|DC7|DKFZp564F0223|FLJ20492|PEP11
Gene Description vacuolar protein sorting 29 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAGHRLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGLIHGHQVIPWGD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VPS29 (NP_476528, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51699

Enviar uma mensagem


VPS29 polyclonal antibody (A01)

VPS29 polyclonal antibody (A01)