HECA polyclonal antibody (A01)
  • HECA polyclonal antibody (A01)

HECA polyclonal antibody (A01)

Ref: AB-H00051696-A01
HECA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HECA.
Información adicional
Size 50 uL
Gene Name HECA
Gene Alias HDC|HDCL|HHDC|dJ225E12.1
Gene Description headcase homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq CHLQGRLMHLYAVCVDCLEGVHKIICIKCKSRWDGSWHQLGTMYTYDILAASPCCQARLNCKHCGKPVIDVRIGMQYFSEYSNVQQCPHCGNLDYHFVKPFSSFKVLEAY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HECA (NP_057301, 434 a.a. ~ 543 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51696

Enviar uma mensagem


HECA polyclonal antibody (A01)

HECA polyclonal antibody (A01)