FKBP7 MaxPab mouse polyclonal antibody (B02)
  • FKBP7 MaxPab mouse polyclonal antibody (B02)

FKBP7 MaxPab mouse polyclonal antibody (B02)

Ref: AB-H00051661-B02
FKBP7 MaxPab mouse polyclonal antibody (B02)

Información del producto

Mouse polyclonal antibody raised against a full-length human FKBP7 protein.
Información adicional
Size 50 uL
Gene Name FKBP7
Gene Alias FKBP23|MGC9420|PPIase
Gene Description FK506 binding protein 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FKBP7 (NP_851939.1, 1 a.a. ~ 222 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 51661

Enviar uma mensagem


FKBP7 MaxPab mouse polyclonal antibody (B02)

FKBP7 MaxPab mouse polyclonal antibody (B02)