STYXL1 purified MaxPab mouse polyclonal antibody (B02P)
  • STYXL1 purified MaxPab mouse polyclonal antibody (B02P)

STYXL1 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00051657-B02P
STYXL1 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human STYXL1 protein.
Información adicional
Size 50 ug
Gene Name STYXL1
Gene Alias DUSP24|MK-STYX
Gene Description serine/threonine/tyrosine interacting-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEYDESHVITALRVKKKNNEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDGKDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILPFLRHMCHFIEIHHHLGSVILIFSTQGISRSCA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STYXL1 (NP_057170.1, 1 a.a. ~ 313 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51657

Enviar uma mensagem


STYXL1 purified MaxPab mouse polyclonal antibody (B02P)

STYXL1 purified MaxPab mouse polyclonal antibody (B02P)