PPIL1 monoclonal antibody (M01), clone 2C2
  • PPIL1 monoclonal antibody (M01), clone 2C2

PPIL1 monoclonal antibody (M01), clone 2C2

Ref: AB-H00051645-M01
PPIL1 monoclonal antibody (M01), clone 2C2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPIL1.
Información adicional
Size 100 ug
Gene Name PPIL1
Gene Alias CGI-124|CYPL1|MGC678|PPIase|hCyPX
Gene Description peptidylprolyl isomerase (cyclophilin)-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPIL1 (NP_057143, 76 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51645
Clone Number 2C2
Iso type IgG2a Kappa

Enviar uma mensagem


PPIL1 monoclonal antibody (M01), clone 2C2

PPIL1 monoclonal antibody (M01), clone 2C2