TMBIM4 purified MaxPab mouse polyclonal antibody (B01P)
  • TMBIM4 purified MaxPab mouse polyclonal antibody (B01P)

TMBIM4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051643-B01P
TMBIM4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human TMBIM4 protein.
Información adicional
Size 50 ug
Gene Name TMBIM4
Gene Alias CGI-119|GAAP|S1R|ZPRO
Gene Description transmembrane BAX inhibitor motif containing 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MADPDPRYPRSSIEDDFNYGSSVASATVHIRMAFLRKVYSILSLQVLLTTVTSTVFLYFESVRTFVHESPALILLFALGSLGLIFALILNRHKYPLNLYLLFGFTLLEALTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKKDFSKFGAGLFALLWILCLSGFLKFFFYSEIMELVLAAAGALLFCGFIIYDTHSLMHKLSPEEYVLAAISLYLDIINLFLHLLRFLEAVNKK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen TMBIM4 (AAI56585.1, 1 a.a. ~ 238 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51643

Enviar uma mensagem


TMBIM4 purified MaxPab mouse polyclonal antibody (B01P)

TMBIM4 purified MaxPab mouse polyclonal antibody (B01P)