DPH5 purified MaxPab mouse polyclonal antibody (B01P)
  • DPH5 purified MaxPab mouse polyclonal antibody (B01P)

DPH5 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051611-B01P
DPH5 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DPH5 protein.
Información adicional
Size 50 ug
Gene Name DPH5
Gene Alias AD-018|CGI-30|HSPC143|MGC61450|NPD015
Gene Description DPH5 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLYLIGLGLGDAKDITVKGLEVVRRCSRVYLEAYTSVLTVGKEALEEFYGRKLVVADREEVEQEADNILKDADISDVAFLVVGDPFGATTHSDLVLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWTDTWRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMSVNQAAQQLLEIVQNQRIRGEEPAVTEETLCVGLARVGADDQKIAAGTLRQMCTVDLGEPLHSLIIT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DPH5 (NP_001070862.1, 1 a.a. ~ 285 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51611

Enviar uma mensagem


DPH5 purified MaxPab mouse polyclonal antibody (B01P)

DPH5 purified MaxPab mouse polyclonal antibody (B01P)