NAG polyclonal antibody (A01)
  • NAG polyclonal antibody (A01)

NAG polyclonal antibody (A01)

Ref: AB-H00051594-A01
NAG polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NAG.
Información adicional
Size 50 uL
Gene Name NAG
Gene Alias DKFZp586G1219|FLJ40407
Gene Description neuroblastoma-amplified protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LEQITAVTTVNDSNCDQELLSLLLDAKLLVKCVSTPFYPRIVDHLLASLQQGRWDAEELGRHLREAGHEAEAGSLLLAVRGTHQAFRTFSTALRAAQHWV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NAG (NP_056993, 2272 a.a. ~ 2371 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51594

Enviar uma mensagem


NAG polyclonal antibody (A01)

NAG polyclonal antibody (A01)