IL23A monoclonal antibody (M01), clone 4C8
  • IL23A monoclonal antibody (M01), clone 4C8

IL23A monoclonal antibody (M01), clone 4C8

Ref: AB-H00051561-M01
IL23A monoclonal antibody (M01), clone 4C8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant IL23A.
Información adicional
Size 100 ug
Gene Name IL23A
Gene Alias IL-23|IL-23A|IL23P19|MGC79388|P19|SGRF
Gene Description interleukin 23, alpha subunit p19
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL23A (NP_057668.1, 1 a.a. ~ 189 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51561
Clone Number 4C8
Iso type IgG2a Kappa

Enviar uma mensagem


IL23A monoclonal antibody (M01), clone 4C8

IL23A monoclonal antibody (M01), clone 4C8