IL23A purified MaxPab mouse polyclonal antibody (B01P)
  • IL23A purified MaxPab mouse polyclonal antibody (B01P)

IL23A purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051561-B01P
IL23A purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IL23A protein.
Información adicional
Size 50 ug
Gene Name IL23A
Gene Alias IL-23|IL-23A|IL23P19|MGC79388|P19|SGRF
Gene Description interleukin 23, alpha subunit p19
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL23A (NP_057668.1, 1 a.a. ~ 189 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51561

Enviar uma mensagem


IL23A purified MaxPab mouse polyclonal antibody (B01P)

IL23A purified MaxPab mouse polyclonal antibody (B01P)