CINP polyclonal antibody (A01)
  • CINP polyclonal antibody (A01)

CINP polyclonal antibody (A01)

Ref: AB-H00051550-A01
CINP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CINP.
Información adicional
Size 50 uL
Gene Name CINP
Gene Alias MGC849
Gene Description cyclin-dependent kinase 2-interacting protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKME
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CINP (NP_116019, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51550

Enviar uma mensagem


CINP polyclonal antibody (A01)

CINP polyclonal antibody (A01)