Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
VPS54 purified MaxPab mouse polyclonal antibody (B01P)
Abnova
VPS54 purified MaxPab mouse polyclonal antibody (B01P)
Ref: AB-H00051542-B01P
VPS54 purified MaxPab mouse polyclonal antibody (B01P)
Contacte-nos
Información del producto
Mouse polyclonal antibody raised against a full-length human VPS54 protein.
Información adicional
Size
50 ug
Gene Name
VPS54
Gene Alias
HCC8|SLP-8p|VPS54L|hVps54L
Gene Description
vacuolar protein sorting 54 homolog (S. cerevisiae)
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr
Immunogen Prot. Seq
MLPTKNRIKREKIHERCKNICPPKDTFERTLLHTHDKSRTDLEQVPKIFMKPDFALDDSLTFNSVLPWSHFNTAGGKGNRDAASSKLLQEKLSHYLDIVEVNIAHQISLRSEAFFHAMTSQHELQDYLRKTSQAVKMLRDKIAQIDKVMCEGSLHILRLALTRNNCVKVYNKLKLMATVHQTQPTVQVLLSTSEFVGALDLIATTQEVLQQELQGIHSFRHLGSQLCELEKLIDKMMIAEFSTYSHSDLNRPLED
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
VPS54 (AAH41868.1, 1 a.a. ~ 824 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
51542
Enviar uma mensagem
VPS54 purified MaxPab mouse polyclonal antibody (B01P)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*