SCLY monoclonal antibody (M09), clone 3B2
  • SCLY monoclonal antibody (M09), clone 3B2

SCLY monoclonal antibody (M09), clone 3B2

Ref: AB-H00051540-M09
SCLY monoclonal antibody (M09), clone 3B2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SCLY.
Información adicional
Size 100 ug
Gene Name SCLY
Gene Alias SCL
Gene Description selenocysteine lyase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP,S-ELISA,ELISA
Immunogen Prot. Seq NSQFPGTQRLPNTCNFSIRGPRLQGHVVLAQCRVLMASVGAACHSDHGDQPSPVLLSYGVPFDVARNALRLSVGRSTTRAEVDLVVQDLKQAVAQLEDQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SCLY (NP_057594, 346 a.a. ~ 444 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51540
Clone Number 3B2
Iso type IgG2a Kappa

Enviar uma mensagem


SCLY monoclonal antibody (M09), clone 3B2

SCLY monoclonal antibody (M09), clone 3B2