SCLY polyclonal antibody (A01)
  • SCLY polyclonal antibody (A01)

SCLY polyclonal antibody (A01)

Ref: AB-H00051540-A01
SCLY polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SCLY.
Información adicional
Size 50 uL
Gene Name SCLY
Gene Alias SCL
Gene Description selenocysteine lyase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq NSQFPGTQRLPNTCNFSIRGPRLQGHVVLAQCRVLMASVGAACHSDHGDQPSPVLLSYGVPFDVARNALRLSVGRSTTRAEVDLVVQDLKQAVAQLEDQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SCLY (NP_057594, 346 a.a. ~ 444 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51540

Enviar uma mensagem


SCLY polyclonal antibody (A01)

SCLY polyclonal antibody (A01)