PPHLN1 monoclonal antibody (M01), clone 4B6
  • PPHLN1 monoclonal antibody (M01), clone 4B6

PPHLN1 monoclonal antibody (M01), clone 4B6

Ref: AB-H00051535-M01
PPHLN1 monoclonal antibody (M01), clone 4B6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPHLN1.
Información adicional
Size 100 ug
Gene Name PPHLN1
Gene Alias HSPC206|HSPC232|MGC48786
Gene Description periphilin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq KVLDKPSRLTEKELAEAASKWAAEKLEKSDESNLPEISEYEAGSTAPLFTDQPEEPESNTTHGIELFEDSQLTTRSKAIASKTKEIEQVRV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPHLN1 (NP_958846.1, 168 a.a. ~ 258 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51535
Clone Number 4B6
Iso type IgG2a Kappa

Enviar uma mensagem


PPHLN1 monoclonal antibody (M01), clone 4B6

PPHLN1 monoclonal antibody (M01), clone 4B6