ANAPC11 monoclonal antibody (M01), clone 1B4-1A4
  • ANAPC11 monoclonal antibody (M01), clone 1B4-1A4

ANAPC11 monoclonal antibody (M01), clone 1B4-1A4

Ref: AB-H00051529-M01
ANAPC11 monoclonal antibody (M01), clone 1B4-1A4

Información del producto

Mouse monoclonal antibody raised against a full length recombinant ANAPC11.
Información adicional
Size 100 ug
Gene Name ANAPC11
Gene Alias APC11|Apc11p|HSPC214|MGC882
Gene Description anaphase promoting complex subunit 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq MGPGPVGKVPGDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ANAPC11 (AAH00607, 1 a.a. ~ 54 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51529
Clone Number 1B4-1A4
Iso type IgG1 kappa

Enviar uma mensagem


ANAPC11 monoclonal antibody (M01), clone 1B4-1A4

ANAPC11 monoclonal antibody (M01), clone 1B4-1A4