ETV7 purified MaxPab rabbit polyclonal antibody (D01P)
  • ETV7 purified MaxPab rabbit polyclonal antibody (D01P)

ETV7 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00051513-D01P
ETV7 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ETV7 protein.
Información adicional
Size 100 ug
Gene Name ETV7
Gene Alias TEL-2|TEL2|TELB
Gene Description ets variant 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEYSLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRALVCGPFFGGIFRLKTPTQHSPVPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIKWEDKDAKIFRV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ETV7 (NP_057219.1, 1 a.a. ~ 341 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51513

Enviar uma mensagem


ETV7 purified MaxPab rabbit polyclonal antibody (D01P)

ETV7 purified MaxPab rabbit polyclonal antibody (D01P)