HSPC152 MaxPab rabbit polyclonal antibody (D01)
  • HSPC152 MaxPab rabbit polyclonal antibody (D01)

HSPC152 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00051504-D01
HSPC152 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HSPC152 protein.
Información adicional
Size 100 uL
Gene Name HSPC152
Gene Alias -
Gene Description hypothetical protein HSPC152
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HSPC152 (NP_057488.1, 1 a.a. ~ 125 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 51504

Enviar uma mensagem


HSPC152 MaxPab rabbit polyclonal antibody (D01)

HSPC152 MaxPab rabbit polyclonal antibody (D01)