HSPC111 purified MaxPab rabbit polyclonal antibody (D03P)
  • HSPC111 purified MaxPab rabbit polyclonal antibody (D03P)

HSPC111 purified MaxPab rabbit polyclonal antibody (D03P)

Ref: AB-H00051491-D03P
HSPC111 purified MaxPab rabbit polyclonal antibody (D03P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human HSPC111 protein.
Información adicional
Size 100 ug
Gene Name NOP16
Gene Alias HSPC111|HSPC185
Gene Description NOP16 nucleolar protein homolog (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKQSGKTSSILCRRGRWRWSDWFTSQLPQAEASPGPVKLEPGCKARRCCVAPEELARSHGIRRLHTHVHTPRSGEGTVLRGSNLYSSGGSRKSQNLLFSGWVM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HSPC111 (AAH32424.1, 1 a.a. ~ 232 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51491

Enviar uma mensagem


HSPC111 purified MaxPab rabbit polyclonal antibody (D03P)

HSPC111 purified MaxPab rabbit polyclonal antibody (D03P)