HSPC111 purified MaxPab mouse polyclonal antibody (B01P)
  • HSPC111 purified MaxPab mouse polyclonal antibody (B01P)

HSPC111 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00051491-B01P
HSPC111 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HSPC111 protein.
Información adicional
Size 50 ug
Gene Name NOP16
Gene Alias HSPC111|HSPC185
Gene Description NOP16 nucleolar protein homolog (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IHC-P,IF
Immunogen Prot. Seq MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HSPC111 (AAH40106.1, 1 a.a. ~ 178 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51491

Enviar uma mensagem


HSPC111 purified MaxPab mouse polyclonal antibody (B01P)

HSPC111 purified MaxPab mouse polyclonal antibody (B01P)