EVL polyclonal antibody (A01)
  • EVL polyclonal antibody (A01)

EVL polyclonal antibody (A01)

Ref: AB-H00051466-A01
EVL polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EVL.
Información adicional
Size 50 uL
Gene Name EVL
Gene Alias RNB6
Gene Description Enah/Vasp-like
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq PGTRAASQPPNSSEAGRKPWERSNSVEKPVSSILSRTPSVAKSPEAKSPLQSQPHSRMKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVKEEIIDAIRQELSGISTT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EVL (NP_057421, 309 a.a. ~ 418 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 51466

Enviar uma mensagem


EVL polyclonal antibody (A01)

EVL polyclonal antibody (A01)