UBE2J1 monoclonal antibody (M01), clone 6A12
  • UBE2J1 monoclonal antibody (M01), clone 6A12

UBE2J1 monoclonal antibody (M01), clone 6A12

Ref: AB-H00051465-M01
UBE2J1 monoclonal antibody (M01), clone 6A12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant UBE2J1.
Información adicional
Size 100 ug
Gene Name UBE2J1
Gene Alias CGI-76|HSPC153|HSPC205|HSU93243|MGC12555|NCUBE1|Ubc6p
Gene Description ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPDSDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2J1 (NP_003329, 9 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 51465
Clone Number 6A12
Iso type IgG2a Kappa

Enviar uma mensagem


UBE2J1 monoclonal antibody (M01), clone 6A12

UBE2J1 monoclonal antibody (M01), clone 6A12